PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g11300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HRT-like
Protein Properties Length: 518aa    MW: 58056.9 Da    PI: 10.126
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g11300genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like54.32.3e-17268298131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 iCGv+l++GsvC r+P+ g+KRC+eHKGm++
  CA07g11300 268 ICGVALGHGSVCIRPPIAGNKRCAEHKGMKV 298
                 8****************************97 PP

2HRT-like46.37e-15326355130
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                 iCG+il+ Gs+C r+P +g+KRC eHKG+R
  CA07g11300 326 ICGFILDCGSPCARKPFQGNKRCLEHKGRR 355
                 8****************************9 PP

3HRT-like58.51.1e-18415445131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 iCGv+l+dGs+C+rqP+ gRKRCe HKGmR+
  CA07g11300 415 ICGVHLNDGSFCTRQPAVGRKRCEGHKGMRV 445
                 8*****************************7 PP

4HRT-like48.11.9e-15487516130
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                 +CG++l +Gs+C+r+P +g+KRC++HKG++
  CA07g11300 487 TCGATLHNGSFCRRKPSEGNKRCWQHKGRK 516
                 7***************************86 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MASADRSLII RLKREDCKRT KHDQAFSDWK ILIGPNDWED HLLGKEGAEK YRTQNLPNCT  60
SCSGVYELGI AVPWLRSTRL DPDHIVPVYV GKSDSVRIRL QRYGREGAHL ENGCSNSELH  120
DNEIISASKR AGLFTETFAR GFSIVYRWAP TNNNKDAERT EAQLLDKFDY AWNKGSNGVR  180
RHNDVLCKLD SISRATHLPA FIRKLQLSLE KQKGVRIKAC KPLLLKNGSD FHDSFKNTNF  240
LPQVFKFGRS QPRIVSFSFG VNDDPNTICG VALGHGSVCI RPPIAGNKRC AEHKGMKVNS  300
VNSKLIAEGN ESTRPCESRG EENAPICGFI LDCGSPCARK PFQGNKRCLE HKGRRNRGFV  360
SQTMTDKIGR STYNPILEYR TSSSKDYQQI LSSRTDIQQF QHFSSSLIHH NHNVICGVHL  420
NDGSFCTRQP AVGRKRCEGH KGMRVKEPIS KQLGSEIPSV FAGSAAKISS GKKHWNIDTP  480
AVNHYPTCGA TLHNGSFCRR KPSEGNKRCW QHKGRKK*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016580607.10.0PREDICTED: protein EFFECTOR OF TRANSCRIPTION 2-like
TrEMBLM1D7670.0M1D767_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000838170.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77412330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.15e-95effector of transcription2